Protein Info for CCNA_00962 in Caulobacter crescentus NA1000

Annotation: MarR-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF22381: Staph_reg_Sar_Rot" amino acids 34 to 115 (82 residues), 61.7 bits, see alignment E=1.5e-20 PF12802: MarR_2" amino acids 43 to 102 (60 residues), 42.7 bits, see alignment E=1.3e-14 PF01047: MarR" amino acids 45 to 103 (59 residues), 49.8 bits, see alignment E=6.5e-17 PF13463: HTH_27" amino acids 46 to 111 (66 residues), 31.4 bits, see alignment E=4.7e-11 PF01638: HxlR" amino acids 65 to 116 (52 residues), 23.2 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 37% identical to SARZ_STAS1: HTH-type transcriptional regulator SarZ (sarZ) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00962)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6T1 at UniProt or InterPro

Protein Sequence (148 amino acids)

>CCNA_00962 MarR-family transcriptional regulator (Caulobacter crescentus NA1000)
MSQKPASSDQPVEILRLDNQLCFALYGAANRMTRLYRPLLDALGLTYPQYLAMLVLWEAS
PRTVGALGEALDLDSSTLTPLLKRLEAGGLVTRDRDPEDERRVIVALTDKGRALRDQAVT
IPEKVFCALDMPLEAMGVLRDRLKTVAR