Protein Info for CCNA_00951 in Caulobacter crescentus NA1000

Annotation: flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR00207: flagellar motor switch protein FliG" amino acids 7 to 336 (330 residues), 245.1 bits, see alignment E=6.4e-77 PF14842: FliG_N" amino acids 12 to 113 (102 residues), 87 bits, see alignment E=2.5e-28 PF14841: FliG_M" amino acids 123 to 194 (72 residues), 80.7 bits, see alignment E=1.5e-26 PF01706: FliG_C" amino acids 223 to 329 (107 residues), 136.8 bits, see alignment E=6.9e-44

Best Hits

Swiss-Prot: 100% identical to FLIG_CAUVC: Flagellar motor switch protein FliG (fliG) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 100% identity to ccr:CC_0906)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6V1 at UniProt or InterPro

Protein Sequence (340 amino acids)

>CCNA_00951 flagellar motor switch protein FliG (Caulobacter crescentus NA1000)
MAMKLAVNDVKNLSGPEKAAIVLLALGEDHTRIWEALDDEEIKEVSQAMAGLGTVSASVV
EDLLVEFVSGMSSTGAIMGSYEQTQRLLASFMPQDKVDALMEEIRGPAGRTMWDKLGNVN
EAVLANYLKNEYPQTVAVVLSKVKSDHAARVLACLPEDFALECVTRMLRMEPVQREILDK
IEMTLRTEFMSNLARTSKRDSHEMMAEIFNNFDRQTEARFIAALEERNREAAERIRALMF
VFEDLSKLDPGGIQTLLRGTPKEQLALALKGASDKLRDLFFSNMSERAAKIMREDMDSMG
PVRLKDVDAAQVGMVQVAKDLAAKGEIMLAGSGADDELIY