Protein Info for CCNA_00950 in Caulobacter crescentus NA1000

Annotation: flagellar M-ring protein FliF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 18 to 455 (438 residues), 266.1 bits, see alignment E=4.1e-83 PF01514: YscJ_FliF" amino acids 40 to 212 (173 residues), 204.8 bits, see alignment E=1e-64 PF08345: YscJ_FliF_C" amino acids 244 to 408 (165 residues), 147.2 bits, see alignment E=5e-47

Best Hits

Swiss-Prot: 100% identical to FLIF_CAUVC: Flagellar M-ring protein (fliF) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 100% identity to ccr:CC_0905)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6R7 at UniProt or InterPro

Protein Sequence (554 amino acids)

>CCNA_00950 flagellar M-ring protein FliF (Caulobacter crescentus NA1000)
MESFLGSIRQFGVGRLAAMLGVGAGVVAVLVALVMFMGKEPSELLYSNLDLKEASEVTQA
LDQAGIKYETKGDGSTIMVPRDKVASARLMVAGKGLVSSGSIGYEIFDTNNALGQTDFVQ
QLNRQRALQGELERTIKAMQGVNSVRVHLVLPKRQLFEEDAEQPSAAVTIGVGSREPSSD
MVRAIQNLVSSSVPNMKAEKVAVIDQHGKTLSAPSDESLAGKMAQDRKSEVEARIAKTVK
DMIEGVLGPGKARVNVTAELDLNRVTTQEERFDPDGQVIRSESTTEASSQENKNDDNAGV
TAAANVPGGQGANGFQQLGSRTGQNDAVTNYEISKSVTTTVQEPGTIKKIAVAVAIDGVS
APMAADGKPGAYTPRTAQEIQQIEELVKTAVGFDAERGDQVRVTNIKFPQPEDQGLEEQG
LLAGFDKNDIMRAAELGVLAVVALLILLFAVRPFIKNLSAPAPGQIALAGPSGGPPVTRL
VTLADGTQQQVVVDQSGEPIALAGPPVSDIDQRIDIAKIEGQVKASSIKRVSEFVEKHPD
ESVAILRNWLHEST