Protein Info for CCNA_00947 in Caulobacter crescentus NA1000

Annotation: flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03506: flagellar hook-basal body protein" amino acids 6 to 298 (293 residues), 140.9 bits, see alignment E=4.1e-45 amino acids 294 to 571 (278 residues), 139 bits, see alignment E=1.6e-44 PF00460: Flg_bb_rod" amino acids 7 to 37 (31 residues), 39.4 bits, see alignment (E = 6.9e-14) PF07559: FlaE" amino acids 334 to 470 (137 residues), 44.4 bits, see alignment E=3.6e-15 PF06429: Flg_bbr_C" amino acids 512 to 589 (78 residues), 58.6 bits, see alignment E=8.1e-20

Best Hits

Swiss-Prot: 100% identical to FLGE_CAUVC: Flagellar hook protein FlgE (flgE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to ccr:CC_0902)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C878 at UniProt or InterPro

Protein Sequence (591 amino acids)

>CCNA_00947 flagellar hook protein FlgE (Caulobacter crescentus NA1000)
MSINSAMLAGVSGLIANSSALAAISDNIANVNTVGFKRSTSNFSTLVTSGNKNQTYSAGG
VKAQTHQFISQQGLTQSTTSNLDISISGAGFFVTTEKPENLTATDTRSFTRAGSFQLDNL
GYLRNDAGLYLQGWLADPVSGLITPDPSDLMQLASINVGSVGGTAEKTTRVGVNANLRSE
QPVAAAVSYKVGTAGSPSKTNVVDSATNSHNYDVVYSSTGIANPVSGNNEYLVDIKENGV
IVATGKVAYDAATNELVSSTIDYKGASPVTGSMTTTRINAAGTTVNLADLGIVNASGADD
AEVVAGKLYDPSTWSMSDYAKDNSKGVKPDFEVQIPLSDSKGGQRTVTLSMLKGPGPNQW
YAELRAKPGDLANNGNGQISTGIIEFTTDGKLKNTGSLFGTTSPTAITIKSSGYIAPTVT
PPAVQPPTPPTWADALGIDEQEVQIDLASAAGGLTQYNSQSVVQSVNTNGTAFGNLTNIE
IDEGGYVSAIFDNGVTRRIAQVAIATFSNPNGLKGVNGNAYRVTNESGTYSLKAPSQGGA
GALAPSTLEASTVDLSQEFTGLITTQRAYSASSKIITTADQMLEELLNIKR