Protein Info for CCNA_00940 in Caulobacter crescentus NA1000

Annotation: sensory box GGDEF/EAL protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 227 to 389 (163 residues), 109.1 bits, see alignment E=9.6e-36 PF00990: GGDEF" amino acids 229 to 384 (156 residues), 121.1 bits, see alignment E=4.1e-39 PF00563: EAL" amino acids 406 to 637 (232 residues), 213.2 bits, see alignment E=3.7e-67

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0896)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6Q5 at UniProt or InterPro

Protein Sequence (677 amino acids)

>CCNA_00940 sensory box GGDEF/EAL protein (Caulobacter crescentus NA1000)
MFGAANLFRRIRNLFAIRRDQPELVIAQARALAWQVPLMYVVVLANAYALAASHLRVAPL
WLNIGLPALLTVVCAIRGVGWLKIGRAGVDPERAARMLAGTLKTSGFLAALFAGWSLALY
PYGDAYQKAHIAFYMSITVIACIFCLMHLRGAAILVTLVVLGSMVVFFGTTGQPVFQAMA
ANIVVVSAVMIVILLTQYREFSDLVQSRVTLTQKAEEARRLSDENDRLANLDSLTDLPNR
RRYFAELDARVEAARQSGRGFVAGVIDLDDFKPINDAFGHATGDRLLIEVGRRLKAFDGA
PILAARLGGDEFGLIIDAALEPDALRVLGRELCASLQATYDLRGVRAQVGASIGFCPFPS
GADTSEQLFERADYALYHAKQNGKGAAVVFDERHEAAIRDMAVVEQALRSADLEQEMSVH
FQPLVDIVSQRTIALEALARWTSPEIGPIRPDVFIGAAERSGQIVEITRLLVAKALREMR
AWPMDVRVSINLSARDIASMENVRRLLAIVSESCIAPHRIDFEITETAIVCDFDQARDAL
AAFHELGVRTALDDFGTGHSSLSHLRLLPLDKLKIDASFVSDIEHNPTSEDIVRTVLQLG
RNLRMECVVEGVETEAQRDRVAALGATVMQGYHFARPMPAEAVPGYLNGEAVSAARRRRG
RGAGPDVWDGDFCREAG