Protein Info for CCNA_00930 in Caulobacter crescentus NA1000

Annotation: riboflavin synthase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 200 (200 residues), 168.8 bits, E=4.4e-54
• PF00677: Lum_binding
  • amino acids 3 to 86 (84 residues), 68.8 bits, E=1.7e-23
  • amino acids 99 to 189 (91 residues), 72.7 bits, E=1e-24

Best Hits

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 100% identity to ccs:CCNA_00930)

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Sequence Analysis Tools

See A0A0H3C6P4 at UniProt or InterPro

Protein Sequence (205 amino acids)

>CCNA_00930 riboflavin synthase alpha chain (Caulobacter crescentus NA1000)
MFSGIIERVGRVEAVTPEAGGALRLSLATGYPDLELGESVAVNGVCLTVVRHDPGGEADF
FVSPETLDRTNLGGARAGHSVNLERAVTLSTRLSGHLVQGHVDGLARLIERHDDGGAWRV
VFSLPAGLHRFCVEKGSIALNGVSLTLNTVGACAPDGRFAVGLTLIPHTWTHTNLQHLAL
NDPVNVEVDVLAKYVEQLCRAYLKP