Protein Info for CCNA_00904 in Caulobacter crescentus NA1000

Annotation: inositol ABC transport system, permease protein IatP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 264 to 295 (32 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 320 (269 residues), 133.1 bits, see alignment E=5.2e-43

Best Hits

Swiss-Prot: 32% identical to ARAH_SHIFL: L-arabinose transport system permease protein AraH (araH) from Shigella flexneri

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to ccr:CC_0861)

MetaCyc: 32% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5V7 at UniProt or InterPro

Protein Sequence (332 amino acids)

>CCNA_00904 inositol ABC transport system, permease protein IatP (Caulobacter crescentus NA1000)
MTAPSSPAPLATDKPRFDLLAFARKHRTILFLLLLVAVFGAANERFLTARNALNILSEVS
IYGIIAVGMTFVILIGGIDVAVGSLLAFASIAAAYVVTAVVGDGPATWLIALLVSTLIGL
AGGYVQGKAVTWLHVPAFIVTLGGMTVWRGATLLLNDGGPISGFNDAYRWWGSGEILFLP
VPVVIFALVAAAGHVALRYTRYGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGALAGL
SGFLLSARLGSAEAVAGTGYELRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLSNGLV
MLHVTSYVQQVVIGLIIVAAVAFDHYARTHKA