Protein Info for CCNA_00891 in Caulobacter crescentus NA1000

Annotation: transporter, drug/metabolite exporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details PF00892: EamA" amino acids 9 to 140 (132 residues), 40 bits, see alignment E=2.4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00891)

Predicted SEED Role

"FIG006442: Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6R4 at UniProt or InterPro

Protein Sequence (312 amino acids)

>CCNA_00891 transporter, drug/metabolite exporter family (Caulobacter crescentus NA1000)
MTLSRNLLLGLLCGVIAGAFWGGVFLAPKLLADFTPLQATAGRYLAYGLAAAVLLAPSWK
AVMARMDGRDWRDLLLLSLLGNLIYYVGLAIAVQSAGVALASLVIGLLPVTITLVGAKAG
EGTPLRRLVWPLALIVAGGVCINLDAFAAAGRAGMSKTLVGLLGALLALAVWTAYAVWNA
RRLAATPKFNSHEWSLLTGVATGLLSLVIVVPAFAFDGKTHAAGAWGLFWGVSFAVAIGA
SVIGNGLWNAASRLLPLSLSGQLIVFETVFALLYGFLHEGRWPRSLESVAMALMLAGVLW
SARLHRGMVGPA