Protein Info for CCNA_00866 in Caulobacter crescentus NA1000

Updated annotation (from data): 2-keto-3-deoxyxylonate dehydratase XylX (EC 4.2.1.141)
Rationale: Important for utilizing D-Xylose. It was previously reported to be involved in xylose catabolism and named xylX (see CC0823 and PMC1855722). It is distantly related to the characterized 2-keto-3-deoxyxylonate dehydratase from Haloferax volcanii (PMC2785657)
Original annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0823)

MetaCyc: 100% identical to 2-dehydro-3-deoxy-D-arabinonate dehydratase (Caulobacter vibrioides CB15)
RXN-8777 [EC: 4.2.1.141]

Predicted SEED Role

"predicted 2-keto-3-deoxyxylonate dehydratase" in subsystem Xylose utilization

MetaCyc Pathways

D-xylose degradation V (5/5 steps found)
D-xylose degradation III (4/5 steps found)
D-arabinose degradation III (3/6 steps found)
superpathway of pentose and pentitol degradation (12/42 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4T2 at UniProt or InterPro

Protein Sequence (384 amino acids)

>CCNA_00866 2-keto-3-deoxyxylonate dehydratase XylX (EC 4.2.1.141) (Caulobacter crescentus NA1000)
MGVSEFLPEDWKAATLLGRIDFGEGPTPVLVRGGRVEDVSKIAPTVADLMNAFQPGAVIP
RGEDKGPLEALDIRPVWEDPDGAAPVKLLAPVDLQCLKAAGVTFAVSTLERVIEERARGD
AGEALKIRTLLAERMGGDLKSVEPGSQGAQRLKDALIADGLWSQYLEVAIGPDAEIFTKG
PTLSSMGWGDQVGVRYDSHWNNPEPEVVLLCDGSGLIRGAALGNDVNLRDFEGRSALLLS
KAKDNNASCAIGPFFRLFDETFGLDDVRSAEVELKITGRDNFVLDGKSNMSLISRDPAVL
AGQAYGKQHQYPDGFALFLGTMFAPIQDRDTPGQGFTHKVGDRVRVSTPKLGVLENEVTT
CDKAKPWTFGISALIRNLAGRGLL