Protein Info for CCNA_00857 in Caulobacter crescentus NA1000
Updated annotation (from data): D-xylose transporter
Rationale: Specifically important for D-xylose utilization. Also see PMC2168598 and PMC344409. May also be important for lactose utilization, which is not explained.
Original annotation: glucose/fructose transport protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to GLCP_SYNY3: Glucose transport protein (gtr) from Synechocystis sp. (strain PCC 6803 / Kazusa)
KEGG orthology group: K08139, MFS transporter, SP family, sugar:H+ symporter (inferred from 100% identity to ccs:CCNA_00857)Predicted SEED Role
"D-xylose proton-symporter XylE" in subsystem Xylose utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3C6H3 at UniProt or InterPro
Protein Sequence (478 amino acids)
>CCNA_00857 D-xylose transporter (Caulobacter crescentus NA1000) MASVSNAGPSAGMSADGGKVNMTFVAAIVAVATIGGFMFGYDSGVINGTQEGLESAFNLS KLGTGLNVGAILIGCAIGAFAAGRLADVWGRRTVMIISALLFVISAIGTGAAESSIVFII FRLIGGLGVGAASVLCPVYISEVTPANIRGRLSSVQQIMIITGLTGAFVANYALAHTAGS STAEFWLGLPAWRWMFWMQIIPAGVFFLCLLGIPESPRYLVAKGKDAQAEAILSRLFGAG QGAKKVEEIRASLSADHKPTFSDLLDPTTKKLRVILWAGLVLAVFQQLVGINIVFYYGSV LWQSVGFTEDDSLKINILSGTLSILACLLAIGLIDKIGRKPLLLIGSAGMAVTLGVLTWC FSTATTVNGALTLGDQIGLTALIAANLYVIFFNLSWGPVMWVMLGEMFPNQMRGSALAVC GFAQWIANFAISVSFPALAAASLPMTYGFYALSAVVSFFLVQKLVHETRGKELEAMQG