Protein Info for CCNA_00841 in Caulobacter crescentus NA1000

Annotation: carboxylesterase type B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00135: COesterase" amino acids 32 to 514 (483 residues), 299 bits, see alignment E=1.2e-92 PF20434: BD-FAE" amino acids 127 to 283 (157 residues), 33.4 bits, see alignment E=5.2e-12

Best Hits

KEGG orthology group: K03927, carboxylesterase type B [EC: 3.1.1.1] (inferred from 100% identity to ccs:CCNA_00841)

Predicted SEED Role

"Carboxylesterase type B"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5P4 at UniProt or InterPro

Protein Sequence (538 amino acids)

>CCNA_00841 carboxylesterase type B (Caulobacter crescentus NA1000)
MTATRRTLITGAAALGAYAALPRMGFTAEARSPVVATTNGKVRGYLDGEVSVFKGLRYGA
DTGGARRFMPPVKPEPWTEVKDALAYGPASMQTGKGEEGETLSEDCLFLNVWTPARASRK
TGLADGAKRPVMFYIHGGAYNGGSGASPWYEGTKLAKRGDVVVVTVNHRLNAFGYLYLAR
LFNAPSVADSGNVGQLDLVLALQWVRDNIARFGGDPDCVMLFGQSGGGAKIATLMAMPSA
KGLFHRAATMSGQQVTVGGPFNATRRAKAFLDKLGVKDLAALRALPAAEMLAGLKAVDPI
AGSGGVYVGPVLDQRSLLRHPFFPDAAPQSLSIPMMVGNTHDETKGFIGWDAKAFPQTWD
EVIARLPGQFAARIDIDPETVVAFYRQTYPNYSPADVFFAASTAGRSWKAAIIQDEERAK
AGAPAFAYQVNWRSPIQGGIFGAPHTIDIGLVFGTLDAKGSIVGTGPDSVAMSNTMSDAF
IAFARTGDPNGGALPKWEPYTLPRRQTMVFDTVSRLEDDPRGVEREFFNRVPFTQFGT