Protein Info for CCNA_00833 in Caulobacter crescentus NA1000

Annotation: NAD(P)H:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01755: NAD(P)H:quinone oxidoreductase, type IV
  • amino acids 2 to 197 (196 residues), 306.7 bits, E=4e-96
• PF00258: Flavodoxin_1
  • amino acids 6 to 124 (119 residues), 44 bits, E=4e-15
• PF03358: FMN_red
  • amino acids 13 to 125 (113 residues), 47.9 bits, E=1.7e-16

Best Hits

Swiss-Prot: 100% identical to NQOR_CAUVN: NAD(P)H dehydrogenase (quinone) (CCNA_00833) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 100% identity to ccr:CC_0791)

MetaCyc: 58% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Flavoprotein WrbA"

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

See B8H1H5 at UniProt or InterPro

Protein Sequence (199 amino acids)

>CCNA_00833 NAD(P)H:quinone oxidoreductase (Caulobacter crescentus NA1000)
MAKVLVLYYSSYGHLEVMAKAIAEGAREAGASVDIKRVPETVPLEIAKGAHFKLDQDAPV
AKVEDLADYDAIIVGAPTRFGRMASQMAAFFDAAGGLWARGALHGKVAGAFTSTATQHGG
QETTLFSIITNMLHFGTTIVGLDYGHAGQMTLDEITGGSPYGATTIAGGDGSRQPSENEL
TGARYQGRKIAETAIKLHG