Protein Info for CCNA_00823 in Caulobacter crescentus NA1000

Annotation: LuxR-like DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 238 to 261 (24 residues), see Phobius details PF08281: Sigma70_r4_2" amino acids 15 to 60 (46 residues), 33.7 bits, see alignment 4.5e-12 PF04545: Sigma70_r4" amino acids 15 to 60 (46 residues), 31.1 bits, see alignment 2.7e-11 PF00196: GerE" amino acids 17 to 70 (54 residues), 47.1 bits, see alignment E=2.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00823)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4P0 at UniProt or InterPro

Protein Sequence (267 amino acids)

>CCNA_00823 LuxR-like DNA-binding protein (Caulobacter crescentus NA1000)
MAKGEPTLSDQVENLDRLTERERECLRLVDRHMSSKEIARELGLSKHTVDWHLDKARRRL
GAVDRYDAARRVFARARQGLAPPPIASGSDPIWLGAEAFARSAGGVEEGASHDPADATHR
PDAAPEGRHWQGGPSAPRSDELSAGLAAPELGRPAAAHHLERAGAAAQQPVGDAGWSVHG
SRPGGGHPQAGHVQTHRTAGAGDPVHRQRGDGRDIPAGLLLVGLGGGRPNHLSLPLRLAF
IATVMIVTALAFGSILAGLHALEGLFP