Protein Info for CCNA_00806 in Caulobacter crescentus NA1000

Annotation: inner membrane protein translocase component yidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 381 to 406 (26 residues), see Phobius details amino acids 451 to 471 (21 residues), see Phobius details amino acids 514 to 536 (23 residues), see Phobius details amino acids 554 to 578 (25 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 5 to 386 (382 residues), 262.9 bits, see alignment E=6.7e-82 PF14849: YidC_periplas" amino acids 78 to 376 (299 residues), 243.6 bits, see alignment E=4e-76 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 387 to 592 (206 residues), 225.1 bits, see alignment E=8.1e-71 PF02096: 60KD_IMP" amino acids 388 to 592 (205 residues), 200.1 bits, see alignment E=2.4e-63

Best Hits

Swiss-Prot: 100% identical to YIDC_CAUVC: Membrane protein insertase YidC (yidC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 100% identity to ccs:CCNA_00806)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H1E8 at UniProt or InterPro

Protein Sequence (615 amino acids)

>CCNA_00806 inner membrane protein translocase component yidC (Caulobacter crescentus NA1000)
MQNDNKNTLMFIVSAFAILIGYQFFVLGPQQKKAEAEFRAKKAAEQQSAAKAGVTLDANG
NPAPLRLSRDAAKALSPRIEVDTPALSGSIALKGARIDDLFLRKYDETTKKDSPPVELFR
PEGAEHAWFADFGWAGANLPGLPDSRTVWTAAPGQVLRPNSPVTLTYDNGLGLTFTRVIA
VDDQAMFTVTDSVKNNGTNGLQLAPYATVQRQGISDALGKNQIVHEGAIGVLGATDEQKL
EMAKYGKWKKDKPLQSFDSVGGWTGITDKYWLAALIPGQNQAIKAQYRVTNVAGIDVYDV
NFLGPVQVLNPGATVSQTTRLFAGAKTVPLLRKYEYGATPAPAIWEFWNKTKAEIPRFDD
AVDWGMFRFFTRPIFNILEVFYKLVGNFGLAILLLTVVLKLVLYPMADKSYESMAKMKKI
APEVEKLKAKHKDDPAKQQQEMMALYQKEKINPMMGCLPMLIQIPVFYALYKVLTVTIEM
RHAPFFGWIQDLSAPDPTTMFNLFGLIPWDPGSLPLIGAMIAHLGVWPLLYGFTMWLTTA
MNPPAGDPIQQKIFQWFPVIFTFTLSGFAVGLVIYWCWSNVLTIFQQYIIMRRYKVENPI
DQIIARLRGKTAGAT