Protein Info for CCNA_00799 in Caulobacter crescentus NA1000

Annotation: ABC transporter, ATP-binding protein cydD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 147 to 187 (41 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 28 to 546 (519 residues), 554.7 bits, see alignment E=1.3e-170 PF00664: ABC_membrane" amino acids 34 to 269 (236 residues), 63.3 bits, see alignment E=6e-21 PF00005: ABC_tran" amino acids 361 to 504 (144 residues), 83.5 bits, see alignment E=4.6e-27 PF13304: AAA_21" amino acids 476 to 535 (60 residues), 27.1 bits, see alignment 8.3e-10

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to ccr:CC_0761)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5L2 at UniProt or InterPro

Protein Sequence (546 amino acids)

>CCNA_00799 ABC transporter, ATP-binding protein cydD (Caulobacter crescentus NA1000)
MGARIVQFDRRDLAKTWLKQWERTVAPTVRRASLLALVDGVAAIAFAAGLALSVDAIAQG
LGAASLAIWLAVAALALAVRGVLAMATGVLGARAAANAKAALRLTLSRAVFAGPRRPAGE
AATALVEGVEALDGHVARFLPTRLSAGVLPLLMIAAAAVASPIAAAIMLGTLIPFILAMI
LTGSAAASEARAQFQALERLSALFLDRVRALPVVLAFQAEGATTVALTRSASNLAERTIR
VLRVAFLSSAALEFFAALSVALVAVYCGFNLLRLLPFPVPEQLDLARAFFVLALAPEVYA
PMRRLAAAYHDRQAAEAASESLATFEAPPPCPARAPLAAAPSLRFDGVEIRYPDTDAPAV
RDFDLVAPAGSITALVGTSGAGKSSILNALLGLAPVTGGAISVNDNPLTDISSDAAWAGQ
SPLILPASIADNIALARRDASRAEIAEAAQRAGLGPALAVRPGGLDFVLDERGSGLSGGE
RRRLSLARALLKPAPILLLDEPTANLDAEAEAAMIEAIREAAQGRTTLIATHSEAVAALA
DKVVRL