Protein Info for CCNA_00788 in Caulobacter crescentus NA1000

Annotation: transporter, major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 12 to 203 (192 residues), 27.6 bits, see alignment E=1.4e-10 PF07690: MFS_1" amino acids 18 to 292 (275 residues), 107.5 bits, see alignment E=7e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00788)

Predicted SEED Role

"multidrug resistance protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6A6 at UniProt or InterPro

Protein Sequence (438 amino acids)

>CCNA_00788 transporter, major facilitator superfamily (Caulobacter crescentus NA1000)
MTGDTQDGRTNRRAFAILFGVSVATALGNTGMLSVLPAIGREIGIPDALVAGIFSLSAVL
WAVTSPFWARQSDLRGRKPLIMLGLAGFAVSMTLCAIVVSAGLHHLAPPMVIFVLFLLAR
ALFGGFGSAANPATQAYLAERTSREERTQTMASLAGAFGLGTVVGPLLAPLFVLPGVGLA
GPMVAFAALAAGMLVVVHRGLPENFTPGRGDTPPRRRGMGLPWRGEGAALWKDPRLKPFL
IYGFLVATCQTAQTQTLGFLIIDKLGLSPIKAQGFITLAMAAGAVAGLLAQWGLIRMFRM
GPRELMRWGVAAAALGNIVVAFAPDYAAVAIGYAIASLGYGFARPGFTAGASLSVEAKDQ
AGAAGAIAAINGLNVVVAPLFVLLYEQIGWAPFVLNTVILLAMLVYAMRQVMLRSVNQGD
ADKEATIAGLERSDEGGV