Protein Info for CCNA_00787 in Caulobacter crescentus NA1000

Annotation: chemotaxis motA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 63 (27 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details TIGR03818: flagellar motor stator protein MotA" amino acids 1 to 283 (283 residues), 365.4 bits, see alignment E=8.6e-114 PF20560: MotA_N" amino acids 4 to 95 (92 residues), 107.2 bits, see alignment E=4.1e-35 PF01618: MotA_ExbB" amino acids 131 to 232 (102 residues), 51.6 bits, see alignment E=8.4e-18

Best Hits

Swiss-Prot: 37% identical to MOTA_RHIME: Motility protein A (motA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to ccs:CCNA_00787)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5K4 at UniProt or InterPro

Protein Sequence (288 amino acids)

>CCNA_00787 chemotaxis motA protein (Caulobacter crescentus NA1000)
MFQIIGIVLLFAMVFGSYIMAGGKMDVIIHAAPHELMAIGGAGVAAFLIGNSVTVIKATL
GGFGTIFKGPKWKAQDYRDLLSLLFLLTKTMKSKGVIALEAHIEKPHESTIFSRYPKIAH
DHFAVDFICDTLRMMTMNLEDPHQVEDAMEKQLEKHHHEAHGAAHALTQLSDGLPALGIV
AAVLGVIKTMGSITEPPAVLGTMIGGALVGTFMGVFMAYGLVGPMATRLGGVLDEDHNFY
KIIQAVLVAHLHGNAAQISVEIGRGNVPSAYQPSFAELEEALSQMPNE