Protein Info for CCNA_00782 in Caulobacter crescentus NA1000

Annotation: aminobenzoyl-glutamate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 141 to 173 (33 residues), see Phobius details amino acids 182 to 195 (14 residues), see Phobius details amino acids 230 to 247 (18 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 433 to 451 (19 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details amino acids 494 to 518 (25 residues), see Phobius details PF03806: ABG_transport" amino acids 18 to 531 (514 residues), 719.9 bits, see alignment E=1.3e-220 PF03606: DcuC" amino acids 101 to 483 (383 residues), 32.5 bits, see alignment E=3.6e-12

Best Hits

KEGG orthology group: K12942, aminobenzoyl-glutamate transport protein (inferred from 100% identity to ccs:CCNA_00782)

Predicted SEED Role

"Aminobenzoyl-glutamate transport protein" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6A0 at UniProt or InterPro

Protein Sequence (539 amino acids)

>CCNA_00782 aminobenzoyl-glutamate transport protein (Caulobacter crescentus NA1000)
MSDAAPPVSSPPPRQKGLLGVVERLGNLLPEPVMIFVWLILGLMVLSAIGQALGWSASIT
YAGDEAPQFGELENGVLTYAASSLFSEANLARLFTEMPKTLTSFAPLGLVLVVILGAAVA
ERSGLFSALIRASLREAPKRILTPLVVIIGMVSHHASDAAYVVFIPLAGLLYAAVGRHPL
AGIAAGFAAVSGGFAGNLTPGQFDVVLFGFTQEAARIIDPTWTMNPLGNWWYILAIVVVF
TPIAWFLTDKVVEPRLGPWGGQADDALKAELAKSAVTADEKRGLKFAGLAALAIVALFAA
LSLIPGFTPLIDETKTGPAQLTPFYGALIAGFMMLFLAGGVAYGVGVGTVKTEGDVVNMM
ADGVRSVAPYIVFAFFAAHFVAMFNWSRLGPIAAIHGAETLKAMNLPAPLLLVSVLGFSS
VLDLFIGSASAKWSALAPVVVPMFMLLGISPEMTTAAYRMGDSFTNLMTPLMSYFPLVLA
MTRRWDPSMGVGSLLALMLPYALAFMVAGVAMTLAWVAFDWPLGPAAQVHYTPPGGLLK