Protein Info for CCNA_00760 in Caulobacter crescentus NA1000

Annotation: two component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details PF00512: HisKA" amino acids 200 to 265 (66 residues), 65.8 bits, see alignment E=4.3e-22 PF02518: HATPase_c" amino acids 313 to 425 (113 residues), 96.7 bits, see alignment E=1.8e-31 PF00072: Response_reg" amino acids 450 to 560 (111 residues), 87.3 bits, see alignment E=1.2e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00760)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5H6 at UniProt or InterPro

Protein Sequence (566 amino acids)

>CCNA_00760 two component sensor histidine kinase (Caulobacter crescentus NA1000)
MPRFAEWLDQDVTSVTARSLPTLGVRLAICAATALIYALAVDLQGGLLWGLAVASAEAAV
FICSSPQRADRKISHAQRLSYVAAVAWMNIVWWSLAIMLWRQDHPALRMAALCVVCAFLV
HAQAFTARSKTLLLIVGGGSATLLLVLCGVLNDFPPSERLALCAAAIILIIYTAKAAQTN
GQQGRALELAKSQAEAASQAKSEFLALMSHELRTPLNGMLGLSQALKLEPLEPGEREQVE
LLEESGRTLLALLNDVLDMAKIEAGKLDIAPTQEDLSRLAERVVRINQAQAREKGTEITL
EIDPATPRALLFDPLRVRQCLGNLVSNAVKFTPAGQIRVRVTCEAGDQPDRMLAKIIVSD
TGVGMGPAVLARIFTPFEQADPTIARRTGGTGLGLNITRRLAQMMGGSVSVRSTEGKGST
FTLTFGCRLPSAGAAETGGPLSGEHPLRLLVVDDYAVNRKVIAMMLAPLGCEIVEADNGQ
RALDLLAEREVDAVLLDFNMPVMGGLETTRRLRADPRWRKLPIVCLTAGVMDDERAAAAT
AGMDGFIEKPIEMSTLVSTLARVARR