Protein Info for CCNA_00749 in Caulobacter crescentus NA1000

Annotation: ferrous iron transport protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 232 to 257 (26 residues), see Phobius details amino acids 288 to 316 (29 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 370 to 396 (27 residues), see Phobius details amino acids 408 to 430 (23 residues), see Phobius details amino acids 472 to 491 (20 residues), see Phobius details amino acids 503 to 522 (20 residues), see Phobius details amino acids 529 to 550 (22 residues), see Phobius details amino acids 570 to 593 (24 residues), see Phobius details amino acids 600 to 626 (27 residues), see Phobius details PF02421: FeoB_N" amino acids 17 to 176 (160 residues), 174.2 bits, see alignment E=2.9e-55 PF01926: MMR_HSR1" amino acids 17 to 134 (118 residues), 63.6 bits, see alignment E=3.6e-21 TIGR00437: ferrous iron transport protein B" amino acids 224 to 596 (373 residues), 323.8 bits, see alignment E=1.3e-100 PF07670: Gate" amino acids 299 to 395 (97 residues), 78 bits, see alignment E=1.4e-25 amino acids 470 to 600 (131 residues), 65.7 bits, see alignment E=9.7e-22 PF07664: FeoB_C" amino acids 412 to 464 (53 residues), 64.3 bits, see alignment 1.4e-21

Best Hits

KEGG orthology group: K04759, ferrous iron transport protein B (inferred from 100% identity to ccs:CCNA_00749)

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5G5 at UniProt or InterPro

Protein Sequence (631 amino acids)

>CCNA_00749 ferrous iron transport protein B (Caulobacter crescentus NA1000)
MAPDSGAAAPPVIDTARIALVGNPNSGKTALFNALTGSRQKVANYAGVTVERKEGVLTAP
SGRQIRVLDLPGTYSLRARSPDEVVTRDAVLGKLAGEDAPQALVCVADATNLRLVLRLAL
ELKQVGRPFVLALNMFDIAQRQGLRIDVERLQAEIGAPIVTTVATRKRGLPELLEKVEAL
VDREALSGDNVWHEPSPAEIRAAHAEAQRIFKLCVKPPERPDTMTGKIDDVLLHPAAGLV
ILLGLLFVMFQAVFTWATPAMDIIDGGFAALIELTNTRLPQGLLTSFIADGLIAGVGSVL
VFLPQILILFFFILLLEDSGYMARAAFLMDKIMGGAGLHGRAFIPLLSSFACAIPGIMST
RVIDNRQDRLTTILVAPLMTCSARIPVYTLIIGAFIPNQTVWGVLSLQGLVMFGLYASGI
VSALLVSFVIRRVFWRGAVEPFMMELPTYRWPEPRNVLMNLWTRARIFISRAGRIIMPLM
VLVWVLSTFPYPPEGATGPAIDYSIAGQLGQFLAPLMAPIGFNWQMTVALIPGMAAREVA
VAVLGTVYAVGGEDGETGALSTLLKNQWSLASALSFLAWYVFAPQCLPTLGVVKRETNSW
VWPTVMFVYMVGLAYIAAFITYHVAVALGAG