Protein Info for CCNA_00741 in Caulobacter crescentus NA1000

Annotation: 3-hydroxybutyryl-CoA dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13452: MaoC_dehydrat_N
  • amino acids 17 to 127 (111 residues), 36.5 bits, E=5.4e-13
• PF01575: MaoC_dehydratas
  • amino acids 17 to 115 (99 residues), 83.6 bits, E=8.9e-28

Best Hits

Swiss-Prot: 58% identical to PHAJ_RHORT: (R)-specific enoyl-CoA hydratase (phaJ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: None (inferred from 99% identity to ccr:CC_0704)

MetaCyc: 53% identical to (R)-specific enoyl-CoA hydratase (Pseudomonas oleovorans)
RXN-7699 [EC: 4.2.1.119]

Predicted SEED Role

"MaoC family protein"

MetaCyc Pathways

• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• polyhydroxydecanoate biosynthesis (1/3 steps found)
• fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
• 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
• 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.119

Sequence Analysis Tools

See A0A0H3C6G7 at UniProt or InterPro

Protein Sequence (141 amino acids)

>CCNA_00741 3-hydroxybutyryl-CoA dehydratase (Caulobacter crescentus NA1000)
MMQGKFLEELSVGQSAELVRTVGEADIVAFAEVTGDNNPVHLDADYAAQTSFGERIAHGM
LSAGYISAVLGTTLPGPGAIYLSQTLRFKRPVKIGDGVTARATITEIDEAKARVTFATVC
LVNGKPVVEGEAVIMVPRKAA