Protein Info for CCNA_00736 in Caulobacter crescentus NA1000

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 8 to 163 (156 residues), 111.8 bits, see alignment E=1.5e-36 PF01252: Peptidase_A8" amino acids 16 to 156 (141 residues), 131.2 bits, see alignment E=1.7e-42

Best Hits

Swiss-Prot: 100% identical to LSPA_CAUVC: Lipoprotein signal peptidase (lspA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to ccr:CC_0700)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7N8 at UniProt or InterPro

Protein Sequence (168 amino acids)

>CCNA_00736 lipoprotein signal peptidase (Caulobacter crescentus NA1000)
MPSLSITRQGWIAYAIAAVTVVLDQISKLWILGLLGREPGASLPLLGPIHLTMVHNYGMS
FGLLRDSDWGRWLLIGFSILVVIGLAVWVHKATRPLLAVGIGLIIGGAIGNNLIDRVIYG
YVVDFIDVSRLYFPWVFNIADSGISVGVALLLLDSFLSEENKLSHQTE