Protein Info for CCNA_00731 in Caulobacter crescentus NA1000

Annotation: DNA mismatch repair protein mutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 316 (316 residues), 275.5 bits, see alignment E=4e-86 PF02518: HATPase_c" amino acids 22 to 77 (56 residues), 31.7 bits, see alignment 3.6e-11 PF13589: HATPase_c_3" amino acids 24 to 121 (98 residues), 40.3 bits, see alignment E=6.4e-14 PF01119: DNA_mis_repair" amino acids 219 to 335 (117 residues), 127.6 bits, see alignment E=3.9e-41 PF08676: MutL_C" amino acids 453 to 594 (142 residues), 169.1 bits, see alignment E=9.9e-54

Best Hits

Swiss-Prot: 100% identical to MUTL_CAUVC: DNA mismatch repair protein MutL (mutL) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to ccs:CCNA_00731)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H173 at UniProt or InterPro

Protein Sequence (637 amino acids)

>CCNA_00731 DNA mismatch repair protein mutL (Caulobacter crescentus NA1000)
MPIRRLPPETVNRIAAGEVVERPASAIKELVDNAIDAGATRIEVEAHGGGLTRILVADDG
CGLSPEELPVAIERHATSKLAPDADGLWDLLRIHTMGFRGEALPSIGSVARLQISSRAKG
AKDAFSILVEGGQVGEVAPAAFPGPHGARIEVRDLFYATPARLKFMKSERAEALAITEEI
KRQAMANESVGFSLDIDGRRVLRLPPEHPGPQGRLARLAAVLGREFQENALEIDQTRDGV
RLSGFAGLPTYNRGNAAHQYLFVNGRPVRDRLLQGALRAAYADFLARDRHPTAALYVTLE
TTEVDVNVHPAKAEVRFRDPALVRGLIVGALRHALAGAGHRASTTVAAQALDSIRAQQSP
FPGYQPQYQPGPSPAGFSAWREGGWTPPTQRPMDLPGLNEVSARVEPSYGGDLAGVVREA
YAAAAFEDRPPTDYPGATAPFDPVDYPLGAARAQVHETYIVAQTRDGMVIVDQHAAHERL
VYERMKGEMASGGVTRQTLLLPEVVDLDPAEAERVVARAEELAGLGLVLESFGPGAVLVR
ETPALLGKTDAAALVRDIADDLAENGQALALKERLEEVCSTMACHGSVRAGRRLNGAEMN
ALLREMEATPHSGQCNHGRPTYVELKLADIEKLFGRR