Protein Info for CCNA_00730 in Caulobacter crescentus NA1000

Annotation: SkaA-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF13411: MerR_1" amino acids 4 to 72 (69 residues), 55.3 bits, see alignment E=8.6e-19 PF00376: MerR" amino acids 5 to 42 (38 residues), 50.2 bits, see alignment 2.8e-17 PF07739: TipAS" amino acids 133 to 251 (119 residues), 104 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 100% identical to SKGA_CAUVC: HTH-type transcriptional regulator SkgA (skgA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0694)

Predicted SEED Role

"transcriptional regulator, MerR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H172 at UniProt or InterPro

Protein Sequence (255 amino acids)

>CCNA_00730 SkaA-family transcriptional regulator (Caulobacter crescentus NA1000)
MSVYTVKQMARLSGVSVRALHHYDAIGLLKPRAVGANGYRYYDRQDLLRLQQILFHRALE
TPLKDIQAALDQPGFDLAAALRAQRERLAAQAERYARLVDVVDRTLADLEGDETMDDKHL
FEGFDPEKQARHEAWLVEHYGDEATRRIADAKAGMKSWGKKDWSQFQEEAKAIEHDLAKA
LTQGLPVDSAPVTAIMRRHWAWVGRSWNREPTPDAFAGLGHLYQANPEFTARYEAIAPGL
TEYFSEAMRAFARGR