Protein Info for CCNA_00726 in Caulobacter crescentus NA1000

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF02771: Acyl-CoA_dh_N" amino acids 7 to 141 (135 residues), 43.7 bits, see alignment E=6.4e-15 PF02770: Acyl-CoA_dh_M" amino acids 145 to 246 (102 residues), 70.6 bits, see alignment E=2.1e-23 PF00441: Acyl-CoA_dh_1" amino acids 260 to 408 (149 residues), 126.2 bits, see alignment E=2.6e-40 PF08028: Acyl-CoA_dh_2" amino acids 277 to 379 (103 residues), 46.1 bits, see alignment E=1.2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00726)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5E8 at UniProt or InterPro

Protein Sequence (435 amino acids)

>CCNA_00726 acyl-CoA dehydrogenase (Caulobacter crescentus NA1000)
MDFDISPKQRAFLDRVTAFMDEHVYPAIPAYEAEMNVLGAERWKVVQVVEDLKKKAKAAG
LWNFFMPPHSGQTHVDDTFQFEGVQLTNLEYSLIAEQLGKVGFASEVFNCSAPDTGNMEV
LMRYGTLAQKEKWLRPLMNGEIRSAFLMTEPAVASSDATNIETRIERDGDHYVINGRKWW
SSGVGDPRCKVAIVMGKTDPDNASRHAQQSQVLVPLDSPGIEIVRMLPVFGYDDAPHGHA
EVILKNVRVPIEDALLLGEGRGFEIAQGRLGPGRIHHCMRTIGTAEVALEKMCQRLMSRK
AFGKYVSDHSVWEERVADARIDIEMCRLLCLKAADMMDKAGNKSARLEIAMIKVAAPRLA
LKIIDDAIQAHGGGGVTTDFGLAKAYAGIRTLRLADGPDEVHQRTIARMEYGKYGDLMYK
QKAEKEAALHVPGIR