Protein Info for CCNA_00720 in Caulobacter crescentus NA1000

Annotation: type I protein secretion ATP-binding protein/type I protein secretion transmembrane subunit/type I secretion processing peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 392 to 413 (22 residues), see Phobius details amino acids 419 to 445 (27 residues), see Phobius details PF03412: Peptidase_C39" amino acids 29 to 155 (127 residues), 114.1 bits, see alignment E=6.3e-37 PF00664: ABC_membrane" amino acids 187 to 451 (265 residues), 113.3 bits, see alignment E=2.6e-36 PF00005: ABC_tran" amino acids 515 to 664 (150 residues), 115.1 bits, see alignment E=6e-37

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to ccs:CCNA_00720)

Predicted SEED Role

"ABC transporter, HlyB/MsbA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C646 at UniProt or InterPro

Protein Sequence (726 amino acids)

>CCNA_00720 type I protein secretion ATP-binding protein/type I protein secretion transmembrane subunit/type I secretion processing peptidase (Caulobacter crescentus NA1000)
MVARSPLRGRTPLMDIPAELNFARRRRLPVIVGAEAAECGLACMAMVARYHGHDVDLNGL
RQRFTLSMSGATLRSIMGFADHLGFAPRALKVELSALDKVRLPAILHWDLNHFVVLKSVQ
GGRAVVHDPALGARTYSLDELSKHFTGVALELTPSGRFEKITARAPIKLTSLWSRMIGFW
PAFFQILGLSLALQVAVFAMPFQMQLVVDEAIFRADRDLLTVLALGFGALVIIQSAIEAL
RAWALQVFGQMLSFQIVGNLVRHMMRLPSDWYEKRHVGDILSRIGSASAIQDVLTRGVIA
AIIDGLMAVVAIIILLLYAPTLAAVVVGAVALNLGLALALFPAMRARTEEQILESAREQS
HVMETVRAATTIKLMGREAERESSWRNLYANAINAAVSVGKFQISLSFTQALITGLQTVI
VIYLGARTILAGDGFSVGMLFAFLSFRQTFTDRANALINQFIQFKFLNLHLERLADIVTA
ETEAADTAAPRLEVAGALQLKDVSFRYGAADRPVLQGVDLEVAPGEFLAITGASGGGKTT
LLKLMLGLRAPTEGTITLDGQPASPQLWRAWREQVGVVAQDDRLLSGTIADNIAFFDPDL
DMERVQHAAMAAQVHDDIARMPMQYLSLVGDMGSTLSGGQKQRVLLARALYRRPRILVLD
EGTANLDVQTEELIADLIAQLPITRIVVAHRPALLKRASRILVVEGGVLSTTCSELSRAE
PKRAVF