Protein Info for CCNA_00699 in Caulobacter crescentus NA1000

Annotation: LSU ribosomal protein L28P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR00009: ribosomal protein bL28" amino acids 1 to 58 (58 residues), 67.7 bits, see alignment E=4.9e-23 PF00830: Ribosomal_L28" amino acids 3 to 61 (59 residues), 77.3 bits, see alignment E=3.6e-26

Best Hits

Swiss-Prot: 100% identical to RL28_CAUVN: 50S ribosomal protein L28 (rpmB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K02902, large subunit ribosomal protein L28 (inferred from 100% identity to ccr:CC_0661)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H0R5 at UniProt or InterPro

Protein Sequence (99 amino acids)

>CCNA_00699 LSU ribosomal protein L28P (Caulobacter crescentus NA1000)
MSRRCELTGIGPMVGHNVSHSNIKTKRRFLPALSPATLQSESLGQSFKLRISNAALRTLD
FKGGLDTFLLGAKDEQLSPRALKIKAQVKAKAKAAAQAA