Protein Info for CCNA_00664 in Caulobacter crescentus NA1000

Annotation: C4-dicarboxylate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 218 to 245 (28 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 343 to 370 (28 residues), see Phobius details PF00375: SDF" amino acids 5 to 397 (393 residues), 356.4 bits, see alignment E=1e-110

Best Hits

Swiss-Prot: 100% identical to DCTA_CAUVN: C4-dicarboxylate transport protein (dctA) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to ccr:CC_0628)

MetaCyc: 62% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H0N0 at UniProt or InterPro

Protein Sequence (417 amino acids)

>CCNA_00664 C4-dicarboxylate transport protein (Caulobacter crescentus NA1000)
MKSIYVQVLIAIVLGVLVGAIWPQIGVALKPLGDGFIKLIKLVIAPVIFCTVAGGIARMG
DMKAFGRVGVKALIYFEVVSTLALVIGLVVGRLIQPGAGFNIDPATLDASIAAGYVEKAQ
HGEGMVAYLLHLIPDTFIGAFADGNLLQVLVIAILTGFACVRMGDFGEKVAHVLDETSKL
FFGIIHIVVRLAPIGAFGAMGFTIGKYGVEALVQLGALVATFYVTSLLFVLVVLGGIAWV
SGFSIFRFLAYIREELLIVLGTSSSESVLPQMMEKLENAGARRSVVGLVIPTGYSFNLDG
TNIYMTLATLFLAQATNTPLSLGQELALLGVAMLTSKGASGVTGAGFITLAATLAVVPDI
PIAALAILVGVDRFMSECRALTNLVGNGVATLVVARWEGALDRQRLDRVLRGAPATE