Protein Info for CCNA_00635 in Caulobacter crescentus NA1000

Annotation: CHASE2 membrane receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 1 to 48 (48 residues), see Phobius details transmembrane" amino acids 395 to 415 (21 residues), see Phobius details amino acids 435 to 462 (28 residues), see Phobius details amino acids 468 to 486 (19 residues), see Phobius details PF05226: CHASE2" amino acids 48 to 406 (359 residues), 56.1 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00635)

Predicted SEED Role

"FIG00481962: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5X1 at UniProt or InterPro

Protein Sequence (491 amino acids)

>CCNA_00635 CHASE2 membrane receptor (Caulobacter crescentus NA1000)
MKNFVRRASAFAGHLWREFAGSWRRALISFCAGLVVLALIRIPVVERSIIGEPDREMLST
AFKLTKDAVVGDGPPAVLLDIDDATLRQQTYVPVRPGREPTASAPRGMLADLLKFILATP
SSSMPGAVIVDVDIGAPAPDDPQGSEALRQALENWAATPHAPRLIIAREAFAPAVLGLEG
ESPTLPQTDYDPIVAKAQNIHWSTVRVLADLHGTVREFLPFQCVVQNGRVAPLYSAALLA
SEALSGKPPAGSPAALAFEEAPKACANSHAHAHAANHHMDEDGEVIHFQLSLAPRHEEPA
WALLPASWPGFKTCGADSDASVFRRVSASDILAAGPDAGREFLCRRLAIIGGTNSVANDF
QQTPLHMMSGPMILTNAVRGISGTDGGLRQAGFPAQIAALLCISLMITFGFAVSRALRER
YHHRKSRASHWAHHVVLLPLNPVVINLLIGLAAHWVGVAILLVTLKYGFWGFMSAPAFGA
AVAETIQEFSE