Protein Info for CCNA_00624 in Caulobacter crescentus NA1000

Annotation: hypothetical protein with pentapeptide repeats

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00805: Pentapeptide" amino acids 37 to 73 (37 residues), 30.5 bits, see alignment 3.1e-11 amino acids 77 to 114 (38 residues), 37.3 bits, see alignment 2.3e-13 amino acids 156 to 186 (31 residues), 25.8 bits, see alignment (E = 9.8e-10) amino acids 187 to 226 (40 residues), 37.3 bits, see alignment 2.3e-13 amino acids 278 to 314 (37 residues), 24.1 bits, see alignment 3.2e-09 amino acids 305 to 344 (40 residues), 55.4 bits, see alignment 5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00624)

Predicted SEED Role

"FIG00482909: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C568 at UniProt or InterPro

Protein Sequence (387 amino acids)

>CCNA_00624 hypothetical protein with pentapeptide repeats (Caulobacter crescentus NA1000)
MSTLDPLDQRQLSQAAVAHARFRQGEGGRRLIMRFHDLRGLDLSHRDLRGADLTGSDLSD
ARLEGVILEEAILFGALLERANLSLGRLQRADLRGANLRGAILDGADLRQVDFRSGKLAV
ADEASQFVMIRRDVSAARLESASITGATLDGARMDQVLMGEADLSECSLRGATMQGVRLK
NARLRGADFSNANLAGADLRDADLTRAILVGTAIKGARIEGAIIEGVLTAPTPAAIEAAP
TLRQALDSHRQWFATGGASGQVARLEGRDLRPLGTLLANSELTALKARGACLAGMVLAGA
MLQGADLDEADLRGADLRGADLRGASLRGANLSQADLREADLRNLGLETGRDLTTKLDGA
MLRYADLREAKRSGNWPQADTTGARGL