Protein Info for CCNA_00567 in Caulobacter crescentus NA1000

Annotation: alpha-1,2-mannosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 19 to 757 (739 residues), 488 bits, see alignment E=2.2e-150 PF17678: Glyco_hydro_92N" amino acids 39 to 300 (262 residues), 194.7 bits, see alignment E=2.3e-61 PF07971: Glyco_hydro_92" amino acids 306 to 753 (448 residues), 528.8 bits, see alignment E=1.4e-162

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00567)

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C749 at UniProt or InterPro

Protein Sequence (770 amino acids)

>CCNA_00567 alpha-1,2-mannosidase (Caulobacter crescentus NA1000)
MPDKRLCWSKRSLALALTLAIGCGQAAWAQPATDLLAKVDPFVGVDGGGVTGGNTVPGAG
APFGFVSLSPDTTNADTNGYDSRSPIMGFSYTHVSGTGGSGKYGNFRVTPTVGPLRVNHL
HFGKTDERASPGYYTVGLGNTDAERIKVELTATRRVGLQRLTYPASAESHLIFDVSSVIA
MRGRGQRVRLAKVELIDDHTLAGEVTVEGGWNPTPYTLYFHAVTDRPAKAFGAWKAGQGW
METKPGPGRSEGGVQVKSAANRLGLMIEYDTEREFSNRLGAYLTFDTTANRQVQMKLAVS
FISADKARANLDEEAPGWDFDATRRTTEAQWSDALSKIRVEGGREEQQRIFYSALYRSHT
MPHDLTGENVWWTSDEPHYEDFYTLWDTFRTLHPLLTIIQPQRQRDMIRSLLDTYKHTGW
MPDSRIAGANGMTQGGSNGDILIADAVSKKLGGFDVNLAYEAILKNGEVDSDKPFMQGRV
LKDYLKLGYVPFTETRSASRTLEYAYNDFAIAVVAKSLGKTEDAKRYLARSGNWKNLWDD
AIGCVRPRYPNGEWVENYSCTYDYPDRSGPWWDAVFYEGNSLQYSSFVPQDVAGLMANTG
GPDGFVKWLDHLFDGHYSQSNEPDLLAPYLYIHAGRPDRTHEIVRGLMAKHYRLSRTGLP
GNDDAGAMSSWYVWNAMGLYPNAGQPFYYLSAPIFARSQISLEGGKTFVVSAPNTSDENR
YIVGAKLNGKPLERAWISHDELARGGVLELTLAPAPGAWGKSLPKPPQGL