Protein Info for CCNA_00566 in Caulobacter crescentus NA1000

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF02746: MR_MLE_N" amino acids 15 to 111 (97 residues), 110.3 bits, see alignment E=6.6e-36 PF13378: MR_MLE_C" amino acids 133 to 378 (246 residues), 162.5 bits, see alignment E=1.3e-51

Best Hits

Swiss-Prot: 100% identical to MAND2_CAUVC: D-mannonate dehydratase CC0532 (CC_0532) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0532)

Predicted SEED Role

"Starvation sensing protein RspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C643 at UniProt or InterPro

Protein Sequence (403 amino acids)

>CCNA_00566 mannonate dehydratase (Caulobacter crescentus NA1000)
MLKIIDAKVIVTCPGRNFVTLKITTEDGITGVGDATLNGRELSVVSFLQDHMVPSLIGRD
AHQIEDIWQFFYRGSYWRGGPVAMTALAAVDMALWDIKGKVAGLPVYQLLGGACRTGVTV
YGHANGETIEDTIAEAVKYKAMGYKAIRLQTGVPGLASTYGVSKDKMFYEPADNDLPTEN
IWSTAKYLNSVPKLFERAREVLGWDVHLLHDVHHRLTPIEAARLGKDLEPYRLFWLEDSV
PAENQAGFRLIRQHTTTPLAVGEIFAHVWDAKQLIEEQLIDYLRATVLHAGGITNLKKIA
AFADLHHVKTGCHGATDLSPVTMAAALHFDMSITNFGLQEYMRHTPETDAVFPHAYTFSD
GMLHPGDKPGLGVDIDEDLAAKHPYKRAYLPVNRLEDGTMFNW