Protein Info for CCNA_00554 in Caulobacter crescentus NA1000

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08241: Methyltransf_11
  • amino acids 42 to 130 (89 residues), 38.6 bits, E=1.4e-13
• PF13489: Methyltransf_23
  • amino acids 49 to 168 (120 residues), 28.1 bits, E=1.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00554)

Predicted SEED Role

"SAM-dependent methyltransferase 2, in cluster with Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions (EC 3.1.2.6)

MetaCyc Pathways

• methylglyoxal degradation I (2/3 steps found)
• methylglyoxal degradation VIII (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

See A0A0H3C5R0 at UniProt or InterPro

Protein Sequence (268 amino acids)

>CCNA_00554 methyltransferase (Caulobacter crescentus NA1000)
MRRDVLDLRAFYASPLGRVARTMLTRKVEEAWGDTRDLDVLGVGYATPFLDAARAKARRV
VAAMPAQQGVEVWPQGGRNQACLVEDAALPLPNALFDRVLAVHALEEADDPAALLAEIGR
VMAPTGRLIVAVSSRDGVWAGAERTPFGHGRPYSRSQLESLIREAELEPAGWTRALYVPP
LAAMSSWAEGFEQVGATLWPRFAGVILMEAIKQTFAVKPRGHRARARVFAPGVLLPSPAG
PTPARQTGERPVPVNTAPVHKAPSGLDR