Protein Info for CCNA_00550 in Caulobacter crescentus NA1000

Annotation: LacI-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF00532: Peripla_BP_1" amino acids 91 to 337 (247 residues), 65.6 bits, see alignment E=8.2e-22 PF13407: Peripla_BP_4" amino acids 147 to 294 (148 residues), 54.1 bits, see alignment E=2.6e-18 PF13377: Peripla_BP_3" amino acids 189 to 347 (159 residues), 116.6 bits, see alignment E=1.9e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00550)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C633 at UniProt or InterPro

Protein Sequence (348 amino acids)

>CCNA_00550 LacI-family transcriptional regulator (Caulobacter crescentus NA1000)
MWELHGSACCYNRAIGRNQCRDSGPRWMKDQRQVTRALAGNPLIPKPLRDQIVEIAQTHG
YVVNQSARSLRLRKTDTIGVIIPLGHETGQLISDPFFLEMIGRLADEITRRNYAVLLHKV
VVTETGWLERIIQAHRADGLLLIGQSNQHDVLNAVAQTYKPLVVWGAQLPGQTYCAVGSD
NVAGGRLAVAHLVQAGRRKIAFLGATHAPEAAQRFEGYRQGLAEAGLAFDPALVVAAHYT
MDEAREAIADFIATGADFDAVFAFSDVIALAAIAALTEAGRSVPRDVAVVGFDDIVLARH
SAPPLTTVRQDLEFAARKMVDRLFARMAGEPAESALSPVELIVRGSSV