Protein Info for CCNA_00549 in Caulobacter crescentus NA1000

Annotation: transposase, IS2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF13276: HTH_21" amino acids 46 to 100 (55 residues), 37.1 bits, see alignment E=4.7e-13 PF00665: rve" amino acids 115 to 211 (97 residues), 74.2 bits, see alignment E=1.3e-24 PF13683: rve_3" amino acids 200 to 265 (66 residues), 109.9 bits, see alignment E=6.1e-36

Best Hits

Swiss-Prot: 47% identical to YI71_BURM1: Insertion element IS407 uncharacterized 31.7 kDa protein (Bmul_4719) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02772)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5Q5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>CCNA_00549 transposase, IS2 family (Caulobacter crescentus NA1000)
MVGPAAMREGVAHLRTVFEISERRACSIVKADRKMVRYRSRRPPDTELRERLRGLAAERR
RFGYRRLFVLLRREGELSGKNRIYRLYREEGLTVRKRRARRRAIGTRAPILVEAKANARW
SLDFVHDQFAGGRRFRVLNVVDDVTRECLAAIPDTSISGRRVARELSALIARRGRPGMIV
SDNGTEFTSTAILAWAEDHRVAWHYIAPGKPTQNGFVESFNGRMRDELLNETLFFGLDHA
RQKLAAWAEDYNTRRPHSSIGYQTPAAYAAHLNATGRPAAQCGSSTARPVATTAPSGVTN
AETLVRAG