Protein Info for CCNA_00507 in Caulobacter crescentus NA1000

Annotation: cytochrome c1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 254 to 272 (19 residues), see Phobius details PF02167: Cytochrom_C1" amino acids 34 to 278 (245 residues), 308.7 bits, see alignment E=2.4e-96

Best Hits

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 100% identity to ccr:CC_0474)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C704 at UniProt or InterPro

Protein Sequence (281 amino acids)

>CCNA_00507 cytochrome c1 (Caulobacter crescentus NA1000)
MLRKLSIIAAVAGLAFAGQALAAGHPLPPKDVKWSFEGPFGKFDQVQLQRGYKVYREVCA
SCHSMKLVSFRNLGDKGGPFYNEKYKNSNDNPWVKAIAKEYEVADIDSETGDPIKRPATS
ADHFPAPFPNEIAARGANGGALPPDMSLLAKARANGPDYIYSLLVGYVNPPAGLKIGPGQ
HYNPYMAGDLTAYWSGSHEKVPPGGFIAMAQPLKDGQVTFDDGTKSTLDQQAKDVSAFLM
WAAEPKLEQRKQTGFAVIIYLLLLSGLLYASYKRVWRNESH