Protein Info for CCNA_00497 in Caulobacter crescentus NA1000

Annotation: putative rhamnosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 277 to 300 (24 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 20 to 253 (234 residues), 39.4 bits, see alignment E=1.1e-13 PF00535: Glycos_transf_2" amino acids 23 to 167 (145 residues), 66.8 bits, see alignment E=3.5e-22 PF02709: Glyco_transf_7C" amino acids 186 to 249 (64 residues), 26.3 bits, see alignment E=7e-10

Best Hits

KEGG orthology group: K07011, (no description) (inferred from 100% identity to ccs:CCNA_00497)

Predicted SEED Role

"glycosyl transferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6Z5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>CCNA_00497 putative rhamnosyl transferase (Caulobacter crescentus NA1000)
MNSILPSVSTLAVGARPARPNVSVVMVVYRTGEALVESIRHVLAEPLVDEFIIVDNGSSS
RDEDMLRSLALTEPRVVLKQGHGNVGFARGANLGAVTAGGEYIVFLNPDANLQPSCVASL
VTAFKGQPVPTIVGARVLNTDGSEQRGGRRGDVTPISTVLSFGQLTRRYPKLAGFEIHRE
NEPLPGAPVPMPTISGACFAMRRADFVALNGFDEGYFLHVEDIDLCWRARRAGGQVLFQP
NAEVVHLGHTSLEHPVKVEFHKGVGLTRYFIKRADSLQLFAAAVLLAPAIMLMSVCRPLL
WKLTGRPI