Protein Info for CCNA_00488 in Caulobacter crescentus NA1000

Annotation: amino acid efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 66 (26 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 151 to 181 (31 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 206 (190 residues), 117 bits, see alignment E=3.8e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00488)

Predicted SEED Role

"LysE-family efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6Z1 at UniProt or InterPro

Protein Sequence (208 amino acids)

>CCNA_00488 amino acid efflux permease (Caulobacter crescentus NA1000)
MTTPEALIAFTLAAGLLTLTPGLDTALVIRTAAAEGPRRAAGAAIGIGLGCLIWGAAASF
GVGALLTASQTAYTVLKWVGALYLAWTGLRMILKPREAFEPGETRAVDAGPMAALRRGLL
TNLLNPKVGIFYVSFLPQFMPVGVDPARFGLLLTTIHVVEGLLWFALLIAATVPIAGLLR
LPGVVRWLDRTTGLVFVAFGLRLALDRR