Protein Info for CCNA_00485 in Caulobacter crescentus NA1000

Annotation: ribosomal large subunit pseudouridine synthase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00005: pseudouridine synthase, RluA family" amino acids 34 to 339 (306 residues), 277.9 bits, see alignment E=5.1e-87 PF01479: S4" amino acids 38 to 82 (45 residues), 25.2 bits, see alignment 1.1e-09 PF00849: PseudoU_synth_2" amino acids 111 to 272 (162 residues), 109.3 bits, see alignment E=2.2e-35

Best Hits

KEGG orthology group: K06180, ribosomal large subunit pseudouridine synthase D [EC: 5.4.99.12] (inferred from 100% identity to ccs:CCNA_00485)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase D (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4T0 at UniProt or InterPro

Protein Sequence (342 amino acids)

>CCNA_00485 ribosomal large subunit pseudouridine synthase D (Caulobacter crescentus NA1000)
MNDVDDIADDDLLDDVAPPDDSKGERLTADLPENLAGQRLDKVLAPLFPDLSRARLQALI
AEGRLTFDGETVADASRKARAGVYSLVVPPPAPADPEPEALPLSILYEDAHLIVVDKAAG
MAVHPAPGTYNGTLVNALLHHCGASLSGVGGVARPGIVHRLDKDTSGVMVAAKSDAAHRG
LSTLFATHDIDRLYVALTRGAPNPPTGTIQTQIGRSPGDRKKMAVLRAGGREAITHYRVE
AAFGPADRPLAARVACRLETGRTHQIRVHMASKGSPCLGDPVYGAAQPAAAVRERIEAAG
LRRQALHAAVLGFVHPITGETLRFETPLPADMDALEVALATL