Protein Info for CCNA_00472 in Caulobacter crescentus NA1000

Annotation: GDP-mannose 4,6 dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR01472: GDP-mannose 4,6-dehydratase" amino acids 8 to 346 (339 residues), 609.5 bits, see alignment E=8.7e-188 PF01370: Epimerase" amino acids 10 to 256 (247 residues), 255.8 bits, see alignment E=5.7e-80 PF04321: RmlD_sub_bind" amino acids 11 to 179 (169 residues), 32.8 bits, see alignment E=6.3e-12 PF16363: GDP_Man_Dehyd" amino acids 11 to 341 (331 residues), 527.1 bits, see alignment E=3.5e-162

Best Hits

Swiss-Prot: 78% identical to GM4D_RHIFH: GDP-mannose 4,6-dehydratase (gmd) from Rhizobium fredii (strain HH103)

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to ccs:CCNA_00472)

MetaCyc: 68% identical to GDP-mannose 4,6-dehydratase (Brucella abortus 2308)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.47

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5Y5 at UniProt or InterPro

Protein Sequence (358 amino acids)

>CCNA_00472 GDP-mannose 4,6 dehydratase (Caulobacter crescentus NA1000)
MTVESNGKVALITGVTGQDGAYLSELLLSKGYTVHGVKRRSSSFNTGRIEHIYQDPHEPN
PRFFLHYGDMTDSTNLIRIVQQTQPDEIYNLAAQSHVQVSFETPEYTSNADATGTLRLLE
AIRILGLEKKTKFYQASTSELYGLVQEVPQSEKTPFYPRSPYAAAKLYGYWIVVNYREAY
GIHASNGILFNHESPLRGETFVTRKITRAVAAIKQGFQDKLYLGNLDAKRDWGHAREYVR
GMWLMLQQETADDYVLATGETTLVRDFVTKAFSEVGITISWSGAGVDEKGTCAESGKVLV
EVDPRYFRPTEVELLIGDPTKAKEKLGWVHETKWEQLCAEMVAADMINVAREQRRNAE