Protein Info for CCNA_00458 in Caulobacter crescentus NA1000

Annotation: PTS system, N-acetylglucosamine-specific IIBC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 348 to 365 (18 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 5 to 490 (486 residues), 689.1 bits, see alignment E=3.1e-211 PF02378: PTS_EIIC" amino acids 13 to 336 (324 residues), 229.6 bits, see alignment E=5.4e-72 TIGR00826: PTS system, glucose-like IIB component" amino acids 393 to 479 (87 residues), 56.9 bits, see alignment E=2.1e-19 PF00367: PTS_EIIB" amino acids 422 to 454 (33 residues), 43.5 bits, see alignment (E = 1.7e-15) amino acids 512 to 545 (34 residues), 33.7 bits, see alignment (E = 1.9e-12)

Best Hits

KEGG orthology group: K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 100% identity to ccs:CCNA_00458)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5G3 at UniProt or InterPro

Protein Sequence (584 amino acids)

>CCNA_00458 PTS system, N-acetylglucosamine-specific IIBC component (Caulobacter crescentus NA1000)
MRSPLEILQPLGRALMLPIAVLPVAALLLRIGQPDLLGAPALAAATHGMSLSVANTFGAA
GGAIFASLGLIFAIGVAVGLARENHGAAGLAGVVCYVIATKGVEALLVAPPEVAAKAVEG
AKDLAIAAWKAKEIGKLSIPVGILSGVISGALYNRYSTIQLPEYLAFFGGRRFVPIVAGL
AGVVLALLFGAFWSTLEAGVDGLSGLVTASGDLGLVVYGLLNRLLIVTGLHHILNNVVWF
ILGDFNGVTGDLNRFAAGDKTAGAFMSGFFPVMMFGLPAACLAMLHTARPERRKAVAGML
GSLALTSFLTGVTEPIEFTFMFLAPVLFAIHALLTGLSMALMNMLDVKLGFGFSAGLFDY
VLNFNKATRPLLLIPVGLVYGALYYGVFRFAILRFDLKTPGREDEAPPSAQAVTTGGGRG
ADMLAALGGAANLVSVDACTTRLRLIVVDQGLVNEPALKALGARGVVRPSDKALQVVLGP
IADTVAGEIRHAISAPPAPAPAPAPDVSQAAKALLAALGGADNLRDLSVHASRLRVVLND
PQRVDQAALHTAGVRGFVRVGEHAAHVVLGPEAQRIGQAVRAMI