Protein Info for CCNA_00447 in Caulobacter crescentus NA1000

Annotation: chemotaxis protein cheD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF03975: CheD" amino acids 58 to 156 (99 residues), 100.9 bits, see alignment E=2.3e-33

Best Hits

Swiss-Prot: 100% identical to CHED_CAUVN: Probable chemoreceptor glutamine deamidase CheD (cheD) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03411, chemotaxis protein CheD [EC: 3.5.1.44] (inferred from 100% identity to ccs:CCNA_00447)

Predicted SEED Role

"Chemotaxis protein CheD" in subsystem Bacterial Chemotaxis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GZ98 at UniProt or InterPro

Protein Sequence (187 amino acids)

>CCNA_00447 chemotaxis protein cheD (Caulobacter crescentus NA1000)
MTSFHHDDPERAVKVHVTQGESHVTADPNVVMTTVLGSCIAACIRDPQSGVGGMNHFLLP
DSGDGRRDGDAVRYGAYAMEVLINDLLKRGARRERLEAKIFGGAKLFDGLSDVGASNAAF
AERFLRDEGIPIVSSSTGGVSARRVEFWPASGRVRQRLVAVDNAPQDVRRPTPPPMPAVA
SGDVDLF