Protein Info for CCNA_00441 in Caulobacter crescentus NA1000
Annotation: chemotaxis receiver domain protein cheYI
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to CHEY_RHIEC: Probable chemotaxis protein CheY (cheY) from Rhizobium etli (strain CFN 42 / ATCC 51251)
KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 98% identity to cak:Caul_0278)Predicted SEED Role
"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0H3C4N9 at UniProt or InterPro
Protein Sequence (121 amino acids)
>CCNA_00441 chemotaxis receiver domain protein cheYI (Caulobacter crescentus NA1000) MTRTVLTVDDSRTMRDMLRMALAGAGFNVVEAVDGEHGLEVLSAHRPDVIITDINMPKLD GFGFIEAVRVDDDYRAIPILVLTTESDPAKKQRAREAGATGWIVKPFNPEKLVDAIRRVA A