Protein Info for CCNA_00432 in Caulobacter crescentus NA1000

Annotation: AsnC-family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF13404: HTH_AsnC-type" amino acids 13 to 54 (42 residues), 67.1 bits, see alignment E=1.4e-22 PF13412: HTH_24" amino acids 13 to 60 (48 residues), 67.6 bits, see alignment E=8.3e-23 PF01037: AsnC_trans_reg" amino acids 80 to 152 (73 residues), 73.6 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 55% identical to DECR_ECOL6: DNA-binding transcriptional activator DecR (decR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05800, Lrp/AsnC family transcriptional regulator (inferred from 100% identity to ccr:CC_0424)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5E2 at UniProt or InterPro

Protein Sequence (164 amino acids)

>CCNA_00432 AsnC-family transcriptional regulator (Caulobacter crescentus NA1000)
MFSLKADFEMIDLDQIDRRLLAILQEDATVPIAELAERVGLSQTPCWKRVRRLQDAGVIT
ARVALLDREALDLGLTVFVAVKTGHHDEGWLTQFAAGASALPEVVEFYRMSGDVDYLLKV
VVKDIAAYDRFYKRLIATAPLTDVSSSFAMEQIKFTTALPIAPT