Protein Info for CCNA_00422 in Caulobacter crescentus NA1000

Annotation: SDR pteridine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 5 to 124 (120 residues), 26.7 bits, E=7.4e-10
• PF00106: adh_short
  • amino acids 6 to 189 (184 residues), 112.3 bits, E=3.1e-36
• PF13561: adh_short_C2
  • amino acids 11 to 239 (229 residues), 118.8 bits, E=4.5e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0417)

MetaCyc: 49% identical to dihydropterin reductase monomer (Agrobacterium fabrum C58)
RXN-23857 [EC: 1.5.1.50]; 1.5.1.50 [EC: 1.5.1.50]; Pteridine reductase. [EC: 1.5.1.50, 1.5.1.33]

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• folate transformations II (plants) (8/11 steps found)
• tetrahydromonapterin biosynthesis (2/4 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33 or 1.5.1.50

Sequence Analysis Tools

See A0A0H3C5D6 at UniProt or InterPro

Protein Sequence (250 amino acids)

>CCNA_00422 SDR pteridine reductase (Caulobacter crescentus NA1000)
MTSRGAALVTGAGRRIGQVLALEAARAGYDVAIHYRASADEAEETARAVRDLDRRALLVR
ADLSDEDETRSLVAQAAPLGPLTLLINNASAFEDDRVGGLSRASWDRHLETNLRAPIVLA
EAMAAALPADRQGLVVNLIDQRVWRPNPQFFSYTLSKAGLWWATQTLAQALAPRIRVNAI
GPGPTLPSVHQAPGEFEAEAAGVLLQRRASPEEVAAALRYLIDASSVTGQMIAVDGGQHL
GWKTPDIVAP