Protein Info for CCNA_00408 in Caulobacter crescentus NA1000

Annotation: antiporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 27 to 52 (26 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 304 to 336 (33 residues), see Phobius details amino acids 385 to 412 (28 residues), see Phobius details PF05977: MFS_3" amino acids 19 to 408 (390 residues), 118.9 bits, see alignment E=2.2e-38 PF07690: MFS_1" amino acids 30 to 372 (343 residues), 93.8 bits, see alignment E=1e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00408)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C6S0 at UniProt or InterPro

Protein Sequence (422 amino acids)

>CCNA_00408 antiporter protein (Caulobacter crescentus NA1000)
MSDTAAPPSEPALENPTRALLRERDFLLFWAARFVSTLGVQIQSVALGWQVYAIARMTKS
VGESAFLVSMIGLAQFLPLFLLTLVAGETADRRTRKLIVAATLALDAISAGVLLVLALMG
SHQLWPIFAISVLFGASRAFLSPASSAMGPMLVPRPLLPRAIAWNSLSWQAGSIGGPALG
GLLLIHSPALAFGASFGLYLVAALLALSIRKPTKPEPQPGSRVELIKEGLSYVWNNKIVF
GSISLDLFAVILGGATALLPVFAKDVLHIGPGGFGLLRAAPAIGACLVGLYLAANPIRRH
AGKIMFAGVAVFGLATVVFGLSKLVWLSVAALAVLGGADMLSVYVRQTLVQIVTPDAMRG
RVAAVSGVFISASNELGEVESGAAAWLLGPIGAAVFGGVGAMAVTAIWAFLFPELRKADR
LE