Protein Info for CCNA_00368 in Caulobacter crescentus NA1000

Annotation: phosphonates transport system permease protein phnE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 28 to 277 (250 residues), 294.6 bits, see alignment E=3e-92 PF00528: BPD_transp_1" amino acids 106 to 275 (170 residues), 73.8 bits, see alignment E=7.8e-25

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 100% identity to ccr:CC_0363)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C553 at UniProt or InterPro

Protein Sequence (278 amino acids)

>CCNA_00368 phosphonates transport system permease protein phnE (Caulobacter crescentus NA1000)
MMSQAAKIEGAIPPPPKRSASALAFDTLLWGGVILLLIISFQPAEIDKFPQLFTDTEKTQ
GFAQLFFKPFTDAQLFMSMDWSLFIGKMWQTIQMAMWGTALAIIVAIPLGLLGARNIAPV
WVQQPVRRVLDLIRSIPDLVVALIFITAVGLGPFAGVMSIMFNTGGVLAKLFAEAVESID
KGPVEGVRATGAVKLQEIVWGVIPQVAPLWTSYALYRFESSSRAATVLGIIGAGGIGQIL
YDSINAFQFDQTGCIVLVIVVAVSMIDLLSQVIRTRLL