Protein Info for CCNA_00364 in Caulobacter crescentus NA1000

Annotation: deoxyhypusine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF01916: DS" amino acids 45 to 342 (298 residues), 299.6 bits, see alignment E=1.2e-93

Best Hits

Swiss-Prot: 100% identical to DHSL_CAUVC: Deoxyhypusine synthase-like protein (CC_0359) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00809, deoxyhypusine synthase [EC: 2.5.1.46] (inferred from 100% identity to ccr:CC_0359)

Predicted SEED Role

"Deoxyhypusine synthase (EC 2.5.1.46)" (EC 2.5.1.46)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5P8 at UniProt or InterPro

Protein Sequence (364 amino acids)

>CCNA_00364 deoxyhypusine synthase (Caulobacter crescentus NA1000)
MFQRRASKVRETEAMNAPVPNNQKAELLQKVVEHVDITSYDARPIIDSMRKMSFSSRDTA
RAADIFNMALADKGCSTWLILAGSTSAGGCMHVYRDMVKNGMIDAVVATGASIVDMDFFE
ALGFKHYQAAGPVDDNVLRDNYIDRIYDTYIDEEELQACDHTILEICNKLEPRGYSSREF
IWEMGKWLAEGNAKKEGSLIQTAYEEGVPIFCPAFVDSSAGFGLVKHQKEKIAEKKPYLM
IDAVADFRELTDVKIAAGTTGLFMVGGGVPKNFAQDTVVCAEILGVEADMHKYAIQITVA
DVRDGACSSSTLKEAASWGKVSTTYEQMVFAEATTVVPLIASDAYWRKAWEGREKPRWNK
LFGK