Protein Info for CCNA_00349 in Caulobacter crescentus NA1000

Annotation: integrase/recombinase, XerC-CodV family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF02899: Phage_int_SAM_1" amino acids 9 to 96 (88 residues), 52.5 bits, see alignment E=7.3e-18 PF13495: Phage_int_SAM_4" amino acids 9 to 93 (85 residues), 27.1 bits, see alignment E=6.8e-10 PF00589: Phage_integrase" amino acids 122 to 290 (169 residues), 135 bits, see alignment E=3.7e-43

Best Hits

Swiss-Prot: 49% identical to XERC_RHIME: Tyrosine recombinase XerC (xerC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 100% identity to ccs:CCNA_00349)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5N6 at UniProt or InterPro

Protein Sequence (304 amino acids)

>CCNA_00349 integrase/recombinase, XerC-CodV family (Caulobacter crescentus NA1000)
MSARQAYAAWLDHLTLERRASPRTVRAYGDNVLAYLNFLEAHRGEALSLSALAEISAADL
RGYLAWRRQGEHALAPRSLSQALSSIRAFHRYLDQRHGVANAAVDLVRGPRLKIGLPRPV
SEDQARDLITQAAEDTERDPWETARDEAVLTLLWGCGLRISEALSLRMSDAPLAATLRIT
GKGGKTRIVPVLDAVRDAIEAYLDELPFNLAPDEALFRAKRGGPLSPRHVQGLVQTLRGR
LGLSDRVTPHAFRHAFATHLLGAGADLRAIQDLLGHASLSTTQRYTQVDAAGLLAAYQAA
HPKG