Protein Info for CCNA_00346 in Caulobacter crescentus NA1000

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 3 to 461 (459 residues), 546.8 bits, E=1.9e-168
• PF07992: Pyr_redox_2
  • amino acids 4 to 328 (325 residues), 259.8 bits, E=2.2e-80
• PF00890: FAD_binding_2
  • amino acids 5 to 41 (37 residues), 25.1 bits, 5.9e-09
• PF01134: GIDA
  • amino acids 5 to 61 (57 residues), 21 bits, 9.8e-08
• PF12831: FAD_oxidored
  • amino acids 5 to 57 (53 residues), 36.4 bits, 2.4e-12
• PF13738: Pyr_redox_3
  • amino acids 7 to 312 (306 residues), 37 bits, E=1.5e-12
• PF13434: Lys_Orn_oxgnase
  • amino acids 94 to 189 (96 residues), 23.3 bits, E=2.1e-08
• PF00070: Pyr_redox
  • amino acids 176 to 250 (75 residues), 75.2 bits, E=3e-24
• PF02852: Pyr_redox_dim
  • amino acids 347 to 456 (110 residues), 144 bits, E=1.2e-45

Best Hits

Swiss-Prot: 75% identical to DLDH3_PSEPU: Dihydrolipoyl dehydrogenase 3 (lpd3) from Pseudomonas putida

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to ccr:CC_0342)

MetaCyc: 58% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• glycine degradation (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• folate transformations II (plants) (8/11 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)
• folate transformations I (8/13 steps found)
• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• photorespiration II (5/10 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (4/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

See A0A0H3C3C8 at UniProt or InterPro

Protein Sequence (466 amino acids)

>CCNA_00346 dihydrolipoamide dehydrogenase (Caulobacter crescentus NA1000)
MAQYDVVIIGGGPGGYNAAIRAGQLGLKVAIVEGRGKLGGTCLNVGCMPSKALLHASELY
AAATGPEFAKLGIEVKPKLNLSQMMAQKAESVEALTKGVEFLMKKNKVEYVKGWGRIDGV
GKVVVKAEDGSETTLETKNIVIATGSEPTPLPGVSVDNKRIIDSTGALSLPEVPKRLVVV
GAGVIGLELGSVWKRLGAEVTVVEYLDRILPGTDTEVANAFQKILVKQGFKFQLGAKVTG
AEAGAKGVKLSFEPVAGGEAQTIEADYVLVAIGRRPYTQGLGLETVGVTPDKRGMIANDH
FKTGVAGVWVIGDVTSGPMLAHKAEDEGVACIEMIAGKAGHVNYGIIPGVVYTSPEVATV
GKTEDELKAEGVAYKVGKFPFLANSRAKINHETDGFVKILADAKTDRILGAHMIGPNVGD
MIAEYCVAMEFGGASEDVARTCHPHPTRSEALRQAAMGVEGWTMQA